Github Top Repositories
13.2K subscribers
1.02K photos
57 videos
10 files
1.73K links
Top GitHub repositories in one place πŸš€
Explore the best projects in programming, AI, data science, and more.
Download Telegram
Github Top Repositories
Photo
πŸš€ Meet galilai-group/stable-worldmodel: a gem from today's GitHub trending list.

πŸ”— https://github.com/galilai-group/stable-worldmodel
πŸ“ A platform for reproducible world model research and evaluation
──────────────────────────────

The stable-worldmodel repository provides a unified platform for world model research and evaluation. It offers a single interface for data collection, training, and evaluation with model-predictive control across various environments. The repository includes reference implementations of common baselines and planning solvers, allowing researchers to focus on their core contributions.

The library supports multiple data formats, including lance, hdf5, folder, video, and lerobot, and provides tools for format conversion and benchmarking. It also features a large suite of environments, including those from the DeepMind Control Suite, Gymnasium, and OGBench, with factors of variation for evaluating zero-shot generalization.

To get started, users can install the library via PyPI and follow the quick start guide to collect data, train a world model, and evaluate it using model-predictive control. The repository is in active development, with APIs subject to change between minor versions.

The stable-worldmodel library is designed for researchers and developers working on world models, and its unified interface and reference implementations make it an ideal choice for those looking to advance the state-of-the-art in this field.
With stable-worldmodel, the world is your model, and the possibilities are endless.

──────────────────────────────
🧠 Channel: https://t.me/GithubRe
🎯 byoungd/English-level-up-tips landed on trending. Worth a proper look.

πŸ”— https://github.com/byoungd/English-level-up-tips
πŸ“ An advanced guide to learn English which might benefit you a lot πŸŽ‰ . η¦»θ°±ηš„θ‹±θ―­ε­¦δΉ ζŒ‡ε—/英语学习教程/θ‹±θ―­ε­¦δΉ /ε­¦θ‹±θ―­
──────────────────────────────

The English-level-up-tips GitHub repository is a comprehensive guide to learning English, dedicated to the author's past love, W. This project aims to provide a detailed and advanced guide to help individuals improve their English skills.

The guide covers various aspects of the English language, including understanding, vocabulary, listening, reading, speaking, and writing. It also features a chapter on AI and its application in language learning.

The guide is suitable for anyone looking to improve their English skills, from beginners to advanced learners. It's a valuable resource for those who want to learn English in a natural and enjoyable way.

Key features of the guide include its comprehensive coverage of the English language, its use of AI in language learning, and its focus on making learning English a fun and rewarding experience.

The guide is available for online reading on various platforms, including GitHub Pages, GitBook, and Zhihu.

In short, the English-level-up-tips guide is a must-have resource for anyone looking to improve their English skills, and with dedication and practice, you can master the English language and unlock a world of new opportunities.

──────────────────────────────
🧠 Channel: https://t.me/GithubRe
Github Top Repositories
Photo
🎯 Biohub/esm landed on trending. Worth a proper look.

πŸ”— https://github.com/Biohub/esm
πŸ“ No description.
──────────────────────────────

The Biohub/esm GitHub repository presents a groundbreaking world model of protein biology, leveraging the latest advancements in Evolutionary Scale Modeling (ESM). This comprehensive system comprises three primary components: ESMC, ESMFold2, and ESM Atlas.

ESMC is a state-of-the-art protein language model trained on billions of protein sequences, allowing it to learn and represent the rules of protein biology. ESMFold2 builds upon ESMC and is a state-of-the-art structure prediction model that can predict high-resolution, all-atom 3D protein structures directly from amino acid sequences. The ESM Atlas is a vast map of 6.8 billion proteins, organized according to the internal world model of ESMC, enabling the prediction of over one billion structures.

These tools can be utilized through the Biohub Platform or by running the models locally with Hugging Face. The repository provides extensive documentation, including tutorials and preprints, to facilitate understanding and usage. The target audience includes researchers, scientists, and developers interested in protein biology, structure prediction, and world modeling.

Here is a simple example of running ESMC locally:
import torch
from transformers import AutoModelForMaskedLM, AutoTokenizer

# example GFP sequence
sequences = ["MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"]

model = AutoModelForMaskedLM.from_pretrained(
"Biohub/ESMC-6B",
device_map="auto",
).eval()
tokenizer = AutoTokenizer.from_pretrained("Biohub/ESMC-6B")

inputs = tokenizer(sequences, return_tensors="pt", padding=True)
inputs = {k: v.to(model.device) for k, v in inputs.items()}
with torch.inference_mode():
output = model(**inputs)

To get started, simply install the esm library and import the necessary modules. With Biohub/esm, unlock the power of world modeling in protein biology and discover new frontiers in protein structure prediction and design. The future of protein biology is here, and it's being modeled with unprecedented accuracy.

──────────────────────────────
🧠 Channel: https://t.me/GithubRe
❀1
πŸ’‘ Crosstalk-Solutions/project-nomad just hit the trending charts β€” here's why it matters.

πŸ”— https://github.com/Crosstalk-Solutions/project-nomad
πŸ“ Project N.O.M.A.D, is a self-contained, offline survival computer packed with critical tools, knowledge, and AI to keep you informed and empoweredβ€”anytime, anywhere.
──────────────────────────────

Project N.O.M.A.D. is a self-contained, offline-first knowledge and education server that empowers users with critical tools and AI, anytime, anywhere. Key features include an AI chat with knowledge base, information library, education platform, offline maps, data tools, and notes.

To get started, users can follow the Quick Install guide for Debian-based operating systems. For more control, advanced users can use the Docker Compose template to customize their installation.

Technical highlights of Project N.O.M.A.D. include its management UI and API, which orchestrate a collection of containerized tools and resources via Docker. The project is suitable for users who want to access knowledge and education resources offline, including students, researchers, and individuals in areas with limited internet connectivity.

The project is licensed under the Apache License 2.0 and has a growing community with resources like a website, Discord channel, and benchmark leaderboard.

In a nutshell, Project N.O.M.A.D. is the ultimate offline companion for knowledge seekers - empowering minds, anywhere.

──────────────────────────────
🧠 Channel: https://t.me/GithubRe
❀1
🌟 DigitalPlatDev/FreeDomain caught my eye on GitHub Trending today.

πŸ”— https://github.com/DigitalPlatDev/FreeDomain
πŸ“ DigitalPlat FreeDomain: Free Domain For Everyone
──────────────────────────────

DigitalPlat FreeDomain is a platform that offers free domain names to individuals and organizations, promoting a more accessible web. The goal is to make the internet an open space where everyone can have their own online presence, regardless of budget.

Key features include free domain registration with various extensions like .DPDNS.ORG and .US.KG, and the freedom to host with your preferred DNS provider. To get started, simply visit the DigitalPlat FreeDomain Dashboard and follow the tutorial.

From a technical standpoint, the project has grown significantly, now supporting over 500,000 domains. The founder, Edward Hsing, shares the story of how this started as a small DNS experiment and evolved into a reliable service.

The target audience is anyone looking to establish an online presence without the burden of domain costs. Whether you're a developer, blogger, or just starting out, DigitalPlat FreeDomain is a great option.

In short, DigitalPlat FreeDomain is a game-changer for those who want to create a website without breaking the bank - Claim your free domain and start building your online presence today!

──────────────────────────────
🧠 Channel: https://t.me/GithubRe